Whois
Domain Name: nhlnfl.com
Registry Domain ID: 1577228364_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2018-10-20T04:00:05-0700
Creation Date: 2009-11-27T23:04:55-0800
Registrar Registration Expiration Date: 2019-11-27T23:04:55-0800
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: abusecomplaints@markmonitor.com
Registrar Abuse Contact Phone: +1.2083895740
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Registrant Organization: NFL
Registrant State/Province: NY
Registrant Country: US
Admin Organization: NFL
Admin State/Province: NY
Admin Country: US
Tech Organization: NFL
Tech State/Province: NY
Tech Country: US
Name Server: ns3.markmonitor.com
Name Server: ns6.markmonitor.com
Name Server: ns4.markmonitor.com
Name Server: ns5.markmonitor.com
Name Server: ns1.markmonitor.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2018-12-11T01:38:03-0800 <<<
If certain contact information is not shown for a Registrant, Administrative,
or Technical contact, and you wish to send a message to these contacts, please
send your message to whoisrelay@markmonitor.com and specify the domain name in
the subject line. We will forward that message to the underlying contact.
If you have a legitimate interest in viewing the non-public WHOIS details, send
your request and the reasons for your request to abusecomplaints@markmonitor.com
and specify the domain name in the subject line. We will review that request and
may ask for supporting documentation and explanation.
For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
Latest domains:
- boviclic.fr,
- valuta-kurser.no,
- dominospizza.ge,
- littlej.fr,
- mcadamfa.com,
- emit.ch,
- 10tofit.de,
- poderosa.com.pe,
- coldbrewtea.com,
- drchef.com,
- e-logimax.com,
- samuelwood.me,
- profitsonwallstreet.com,
- multrip.me,
- comarsa.com.pe,
- wealthmakerfinancialservices.com.au,
- tustandas.es,
- grashopper.de,
- kehrer-jet.de,
- beijing2022.cn