Whois
simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-
Search on asw (.co.za)
Match: One
Domain: asw.co.za
Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info
Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, accounts@co.za, should this
not be according to your records. You have been sent 0 invoices/statements.
0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : asw.co.za
1b. action :
1c. Registrar : MWEB
2a. registrant : ASW Engineering (Pty) Ltd
2b. registrantpostaladdress: PO Box 814, Randburg, 2125,-, , , --
2c. registrantstreetaddress:
2d. amount :
2e. paymenttype :
2f. billingaccount :
2g. billingemail :
2i. invoiceaddress :
2j. registrantphone : +27.215968300
2k. registrantfax : +27.117934829
2l. registrantemail : dns-admin@mweb.com
2n. vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 1998/02/15 00:00:00
4a. admin :
4b. admintitle :
4c. admincompany :
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax :
4g. adminemail :
4h. adminnic :
5a. tec :
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e. tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic :
6a. primnsfqdn : ns1.mweb.co.za
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : ns2.mweb.co.za
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn :
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :
Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems
Latest domains:
- comarsa.com.pe,
- wealthmakerfinancialservices.com.au,
- tustandas.es,
- grashopper.de,
- kehrer-jet.de,
- beijing2022.cn,
- fivestarpromo.com,
- hangersforshops.com.au,
- vawdas.co.za,
- bushhat.co.za,
- signwaves.co.zw,
- rivov.ro,
- bathroomwarehouse.net.au,
- hocgioitoan.com.vn,
- acizi.ro,
- yss.com.au,
- schantl-quad.at,
- miele.ae,
- plumbingclearancecentre.com.au,
- auraglow.co.uk