Whois
Domain: cerlestes.de
Nserver: ns.inwx.de
Nserver: ns2.inwx.de
Nserver: ns3.inwx.de
Status: connect
Changed: 2008-09-27T17:21:57+02:00
[Tech-C]
Type: ROLE
Name: Hostmaster Of The Day
Organisation: INWX GmbH & Co. KG
Address: Prinzessinnenstr. 30
PostalCode: 10969
City: Berlin
CountryCode: DE
Phone: +49.309832120
Fax: +49.3098321290
Email: hostmaster@inwx.de
Remarks: role account for Hostmaster of The Day
Changed: 2018-01-17T09:48:00+01:00
[Zone-C]
Type: ROLE
Name: Hostmaster Of The Day
Organisation: INWX GmbH & Co. KG
Address: Prinzessinnenstr. 30
PostalCode: 10969
City: Berlin
CountryCode: DE
Phone: +49.309832120
Fax: +49.3098321290
Email: hostmaster@inwx.de
Remarks: role account for Hostmaster of The Day
Changed: 2018-01-17T09:48:00+01:00
Latest domains:
- thearboristmelbourne.com.au,
- treespan.com.au,
- digitalmarketingguide.online,
- cheaptreeremovalmelbourne.com.au,
- ikn.eu,
- visualstory.io,
- imperialclaimsconsultants.co.uk,
- clothingking.shop,
- technewscentury.co.uk,
- oneshotsupplies.com,
- turningpointuk.org,
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me