Whois
simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2019
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-
Search on discountbeds (.co.za)
Match: One
Domain: discountbeds.co.za
Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info
Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, accounts@co.za, should this
not be according to your records. You have been sent 0 invoices/statements.
0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : discountbeds.co.za
1b. action :
1c. Registrar : Domains
2a. registrant : REDACTED
2b. registrantpostaladdress: REDACTED
2c. registrantstreetaddress: REDACTED
2d. amount : REDACTED
2e. paymenttype : REDACTED
2f. billingaccount : REDACTED
2g. billingemail : REDACTED
2i. invoiceaddress : REDACTED
2j. registrantphone : REDACTED
2k. registrantfax : REDACTED
2l. registrantemail : REDACTED
2n. vat : REDACTED
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2017/10/06 12:05:02
4a. admin : REDACTED
4b. admintitle : REDACTED
4c. admincompany : REDACTED
4d. adminpostaladdr : REDACTED
4e. adminphone : REDACTED
4f. adminfax : REDACTED
4g. adminemail : REDACTED
4h. adminnic : REDACTED
5a. tec : REDACTED
5b. tectitle : REDACTED
5c. teccompany : REDACTED
5d. tecpostaladdr : REDACTED
5e. tecphone : REDACTED
5f. tecfax : REDACTED
5g. tecemail : REDACTED
5h. tecnic : REDACTED
6a. primnsfqdn : ns1.tld-ns.net
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : ns2.tld-ns.com
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn : ns3.tld-ns.net
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn : ns4.tld-ns.com
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :
Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems
Latest domains:
- karlvilhjalmsson.com,
- siliconec.co.nz,
- aoborobot.com,
- hcdiagnostics.com,
- ceragran.co.za,
- srikanchimahaswamividyamandir.org,
- himayamms.co.in,
- shreeniketanschools.org,
- infantjesus.co.in,
- internationalvillage.org,
- frithframes.co.uk,
- alimandi.co.za,
- jjsis.org,
- pivott.be,
- dewakan.my,
- michiganagconnection.com,
- mhplus-formulare.de,
- minnesotaagconnection.com,
- avocats-legipole.fr,
- biographica.org