Whois
% The WHOIS service offered by ROTLD and the access to the records in the ROTLD WHOIS database
% are provided for information purposes and to be used within the scope of technical or administrative
% necessities of Internet operation or to remedy legal problems. The use for other purposes,
% in particular for advertising and domain hunting, is not permitted.
% Without prejudice to the above, it is explicitly forbidden to extract, copy and/or use or re-utilise
% in any form and by any means (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior and explicit permission by ROTLD,
% nor in any attempt hereof, to apply automated, electronic processes to ROTLD (or its systems).
% ROTLD cannot, under any circumstances, be held liable in case the stored information would prove
% to be wrong, incomplete or not accurate in any sense.
% You agree that any reproduction and/or transmission of data for commercial purposes will always
% be considered as the extraction of a substantial part of the content of the WHOIS database.
% By submitting the query you agree to abide by this policy and accept that ROTLD can take measures
% to limit the use of its WHOIS services in order to protect the privacy of its registrants or the
% integrity of the database.
% The ROTLD WHOIS service on port 43 never discloses any information concerning the registrant.
% Registrant information can be obtained through use of the web-based whois service available from
% the ROTLD website www.rotld.ro
Domain Name: downdetector.ro
Registered On: 2018-12-02
Expires On: 2020-12-01
Registrar: Eurodns SA
Referral URL: www.eurodns.com
DNSSEC: Inactive
Nameserver: jean.ns.cloudflare.com
Nameserver: pete.ns.cloudflare.com
Domain Status: OK
Latest domains:
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me,
- gdbio.co.za,
- jadefitness.com,
- treeresponse.com.au,
- actionmetals.net,
- icsv26.org,
- simsounds.de,
- dinnxinn.com,
- statewidetrees.com.au,
- westportautoleasing.com,
- protreeremovalbrisbane.com.au,
- gogomongo.com,
- bandrtreeservices.com.au,
- choicesystem.ml