Whois
Domain name:
EBUGS.TK
Organisation:
Freedom Registry, Inc.
2225 East Bayshore Road #290
Palo Alto CA 94303
United States
Phone: +1 650-681-4172
Fax: +1 650-681-4173
Domain Nameservers:
NS01.FREENOM.COM
NS02.FREENOM.COM
NS03.FREENOM.COM
NS04.FREENOM.COM
Your selected domain name is a domain name that has been
cancelled, suspended, refused or reserved at the Dot TK Registry
It may be available for re-registration at http://www.dot.tk
In the interim, the rights for this domain have been automatically
transferred to Freedom Registry, Inc.
Please be advised that the Dot TK Registry, Freenom and
Freedom Registry, Inc. cannot be held responsible for any content
that was previously available at this domain name.
Due to restrictions in Dot TK 's Privacy Statement personal information
about the previous registrants of the domain name cannot be released
to the general public.
Dot TK is proud to work with numerous governmental law enforcement
agencies to stop spam, fraud, phishing attempts, child pornography and
other illicit content on Dot TK websites. These agencies ma
Latest domains:
- poderosa.com.pe,
- e-logimax.com,
- samuelwood.me,
- profitsonwallstreet.com,
- multrip.me,
- comarsa.com.pe,
- wealthmakerfinancialservices.com.au,
- tustandas.es,
- grashopper.de,
- kehrer-jet.de,
- beijing2022.cn,
- fivestarpromo.com,
- hangersforshops.com.au,
- vawdas.co.za,
- bushhat.co.za,
- signwaves.co.zw,
- rivov.ro,
- bathroomwarehouse.net.au,
- hocgioitoan.com.vn,
- acizi.ro