Whois
% .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%
Domain: evertmartin.be
Status: NOT AVAILABLE
Registered: Sun Nov 14 2010
Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.
Registrar Technical Contacts:
Organisation: One.com A/S
Language: en
Phone: +45.46907100
Fax: +45.70205872
Registrar:
Name: One.com A/S
Website: http://www.one.com
Nameservers:
ns01.one.com
ns02.one.com
Keys:
keyTag:17545 flags:KSK protocol:3 algorithm:ECDSAP256SHA256 pubKey:J0hFjC2fBpoe6VnGV6s4aIV1YOUx0wRUD5SYpqIWzaNAYXHlhPE80vhLAW81+Vh75L7guEoNgoFGmqxuIzC9uQ==
Flags:
Please visit www.dnsbelgium.be for more info.
Latest domains:
- thearboristmelbourne.com.au,
- treespan.com.au,
- digitalmarketingguide.online,
- cheaptreeremovalmelbourne.com.au,
- ikn.eu,
- visualstory.io,
- imperialclaimsconsultants.co.uk,
- clothingking.shop,
- technewscentury.co.uk,
- oneshotsupplies.com,
- turningpointuk.org,
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me