Whois
Domain Name: gutewerbung.net
Registry Domain ID: 1646948733_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.udag.net
Registrar URL: http://www.united-domains.de/
Updated Date: 2018-03-24T07:29:24Z
Creation Date: 2011-03-23T10:30:21Z
Registrar Registration Expiration Date: 2019-03-23T10:30:21Z
Registrar: united domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: abuse@united-domains.de
Registrar Abuse Contact Phone: +49.8151368670
Reseller:
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Sebastian Fleischer
Registrant Street: Holunderweg 20
Registrant City: Hamburg
Registrant State/Province:
Registrant Postal Code: 22453
Registrant Country: DE
Registrant Phone: +49.4057220015
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: fleischn@gmail.com
Registry Admin ID:
Admin Name: Sebastian Fleischer
Admin Street: Holunderweg 20
Admin City: Hamburg
Admin State/Province:
Admin Postal Code: 22453
Admin Country: DE
Admin Phone: +49.4057220015
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: fleischn@gmail.com
Registry Tech ID:
Tech Name: Host Master
Tech Organization: united-domains AG
Tech Street: Gautinger Str. 10
Tech City: Starnberg
Tech State/Province: Bayern
Tech Postal Code: 82319
Tech Country: DE
Tech Phone: +49.8151368670
Tech Phone Ext:
Tech Fax: +49.81513686777
Tech Fax Ext:
Tech Email: hostmaster@united-domains.de
Name Server: ns.udag.de
Name Server: ns.udag.org
Name Server: ns.udag.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2018-03-24T07:29:24Z
For more information on Whois status codes, please visit https://www.icann.org/epp
; Whois Server Version 1.86
;
; Terms and conditions:
;
; This data is provided by united-domains AG
; for information purposes, and to assist persons obtaining information
; about or related to domain name registration records.
; united-domains AG does not guarantee its accuracy.
; By submitting a WHOIS query, you agree that you will use this data
; only for lawful purposes and that, under no circumstances, you will
; use this data to
; 1) allow, enable, or otherwise support the transmission of mass
; unsolicited, commercial advertising or solicitations via E-mail
; (spam); or
; 2) enable high volume, automated, electronic processes that apply
; to this WHOIS server.
; These terms may be changed without prior notice.
; By submitting this query, you agree to abide by this policy.
Latest domains:
- cheaptreeremovalmelbourne.com.au,
- ikn.eu,
- visualstory.io,
- imperialclaimsconsultants.co.uk,
- clothingking.shop,
- technewscentury.co.uk,
- oneshotsupplies.com,
- turningpointuk.org,
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me,
- gdbio.co.za,
- jadefitness.com,
- treeresponse.com.au