Whois
Domain Name: mbcgroup.com.ng
Registry Domain ID: 59652-NIRA
Registry WHOIS Server:: whois.nic.net.ng
Registrar URL: www.registeram.com.ng
Updated Date: 2019-06-20T08:27:05.371Z
Creation Date: 2012-01-20T16:35:10.314Z
Registry Expiry Date: 2021-01-20T16:35:10.340Z
Registrar Registration Expiration Date: 2021-01-20T16:35:10.340Z
Registrar: Registeram.com Limited
Registrar IANA ID: 13062013
Registrar Abuse Contact Email: support@registeram.com.ng
Registrar Abuse Contact Phone: +234.8088331688
Registrar Country: NG
Registrar Phone: +234.8088331688
Registrar Customer Service Contact: Registeram.com Limited
Registrar Customer Service Email: support@registeram.com.ng
Registrar Admin Email: admin@registeram.com.ng
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Q1byU-gLUP5
Registrant Name: oshoke louis
Registrant Street: 5/6 Catholic mission street ,St Nicholas House
Registrant City: Lagos Island
Registrant Postal Code: 023401
Registrant Country: NG
Registrant Phone: 08051715867
Registrant Email: admin@louisconsult.com
Name Server: maria.ns.cloudflare.com
Name Server: roan.ns.cloudflare.com
DNSSEC: unsigned
>>> Last update of WHOIS database: 2020-01-08T16:42:52.666Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
TERMS OF USE:
You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated. Whois database is provided by NIRA as a service to the internet community.
The data is for information purposes only. NIRA does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to:
(1) Allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) Enable high volume, automated, electronic processes that apply to NIRA or NIRA Accredited Registrars and their computer systems. The compilation, repackaging, dissemination or other use of this Data is expressly prohibited.
Latest domains:
- ikn.eu,
- visualstory.io,
- imperialclaimsconsultants.co.uk,
- clothingking.shop,
- technewscentury.co.uk,
- oneshotsupplies.com,
- turningpointuk.org,
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me,
- gdbio.co.za,
- jadefitness.com,
- treeresponse.com.au,
- actionmetals.net