Whois
Domain Name: mbx.com.ng
Registry Domain ID: 7937-NIRA
Registry WHOIS Server:: whois.nic.net.ng
Registrar URL: https://domains.mcreal.net/
Updated Date: 2017-02-20T08:30:42.466Z
Creation Date: 2009-05-13T14:55:47.540Z
Registry Expiry Date: 2020-07-31T14:55:52.63Z
Registrar Registration Expiration Date: 2020-07-31T14:55:52.63Z
Registrar: McReal Online Networks Systems Ltd
Registrar Abuse Contact Email: support@mcreal.net
Registrar Abuse Contact Phone: +234.84741118
Registrar Country: NG
Registrar Phone: +234.84741118
Registrar Customer Service Contact: Hostmaster
Registrar Customer Service Email: support@mcreal.net
Registrar Admin Contact: Hostmaster
Registrar Admin Email: info@mcreal.net
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: thcNJ-vP487
Registrant Name: Obinna Oforah
Registrant Organization: ICPC
Registrant Street: 802 Contitution Avenue,Central Area, Garki
Registrant City: Garki
Registrant State/Province: Abuja
Registrant Country: NG
Registrant Phone: +234.8023196471
Registrant Email: tonyunini@gmail.com
Registry Admin ID: 6v7Mo-FhfSQ
Admin Name: Obinna Oforah
Admin Organization: ICPC
Admin Street: 802 Contitution Avenue,Central Area, Garki
Admin City: Garki
Admin State/Province: Abuja
Admin Country: NG
Admin Phone: +234.8023196471
Admin Email: tonyunini@gmail.com
Name Server: ns1.torihouse.net
Name Server: ns2.torihouse.net
DNSSEC: unsigned
>>> Last update of WHOIS database: 2020-01-09T01:18:31.389Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
TERMS OF USE:
You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated. Whois database is provided by NIRA as a service to the internet community.
The data is for information purposes only. NIRA does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to:
(1) Allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) Enable high volume, automated, electronic processes that apply to NIRA or NIRA Accredited Registrars and their computer systems. The compilation, repackaging, dissemination or other use of this Data is expressly prohibited.
Latest domains:
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me,
- gdbio.co.za,
- jadefitness.com,
- treeresponse.com.au,
- actionmetals.net,
- icsv26.org,
- simsounds.de,
- dinnxinn.com,
- statewidetrees.com.au,
- westportautoleasing.com,
- protreeremovalbrisbane.com.au,
- gogomongo.com