Whois
Domain Name: MLN.COM.AU
Registry Domain ID: D407400000002176062-AU
Registrar WHOIS Server: whois.auda.org.au
Registrar URL:
Last Modified: 2019-12-12T00:00:58Z
Registrar Name: Discount Domain Name Services Pty Ltd
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller Name:
Status: ok https://afilias.com.au/get-au/whois-status-codes#ok
Registrant Contact ID: CE9092DDNS
Registrant Contact Name: Jaan
Tech Contact ID: CE9092DDNS
Tech Contact Name: Jaan
Name Server: NS2.MLN.COM.AU
Name Server IP: 103.9.56.94
Name Server: NS1.MLN.COM.AU
Name Server IP: 103.9.56.93
DNSSEC: unsigned
Registrant: CELTURAN PTY LTD
Registrant ID: ACN 103239461
Eligibility Type: Registered Business
Eligibility Name: MOBILE LAPTOPS & NOTEBOOKS
Eligibility ID: VIC BN B2382269N
>>> Last update of WHOIS database: 2019-12-19T06:39:30Z <<<
Afilias Australia Pty Ltd (Afilias), for itself and on behalf of .au Domain Administration Limited (auDA), makes the WHOIS registration data directory service (WHOIS Service) available solely for the purposes of:
(a) querying the availability of a domain name licence;
(b) identifying the holder of a domain name licence; and/or
(c) contacting the holder of a domain name licence in relation to that domain name and its use.
The WHOIS Service must not be used for any other purpose (even if that purpose is lawful), including:
(a) aggregating, collecting or compiling information from the WHOIS database, whether for personal or commercial purposes;
(b) enabling the sending of unsolicited electronic communications; and / or
(c) enabling high volume, automated, electronic processes that send queries or data to the systems of Afilias, any registrar, any domain name licence holder, or auDA.
The WHOIS Service is provided for information purposes only. By using the WHOIS Service, you agree to be bound by these terms and conditions. The WHOIS Service is operated in accordance with the auDA WHOIS Policy (available at https://www.auda.org.au/policies/index-of-published-policies/2014/2014-07/ ).
Latest domains:
- imperialclaimsconsultants.co.uk,
- clothingking.shop,
- technewscentury.co.uk,
- oneshotsupplies.com,
- turningpointuk.org,
- salvageautosofpa.com,
- onexpo.online,
- eties.pw,
- geniptv.pro,
- inf-o.site,
- macoslalertwarningsystemdamagerepair.tk,
- fansong.vip,
- bridgelogisticsinc.com,
- sarahwkee.me,
- gdbio.co.za,
- jadefitness.com,
- treeresponse.com.au,
- actionmetals.net,
- icsv26.org,
- simsounds.de