Whois
Domain Name: PBCGOV.ORG
Registry Domain ID: D25173132-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2018-12-18T21:09:55Z
Creation Date: 2000-04-18T14:32:38Z
Registry Expiry Date: 2024-04-18T14:32:38Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Palm Beach County ISS
Registrant State/Province: FL
Registrant Country: US
Name Server: NS1.PBCGOV.ORG
Name Server: NS2.PBCGOV.ORG
Name Server: NS0.PBCGOV.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2019-11-23T23:47:54Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Latest domains:
- poderosa.com.pe,
- e-logimax.com,
- samuelwood.me,
- profitsonwallstreet.com,
- multrip.me,
- comarsa.com.pe,
- wealthmakerfinancialservices.com.au,
- tustandas.es,
- grashopper.de,
- kehrer-jet.de,
- beijing2022.cn,
- fivestarpromo.com,
- hangersforshops.com.au,
- vawdas.co.za,
- bushhat.co.za,
- signwaves.co.zw,
- rivov.ro,
- bathroomwarehouse.net.au,
- hocgioitoan.com.vn,
- acizi.ro