Whois
% .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%
Domain: plaisirsdu604.be
Status: NOT AVAILABLE
Registered: Thu Feb 27 2014
Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.
Registrar Technical Contacts:
Organisation: Synchrone sprl
Language: fr
Phone: +32.43440003
Fax: +32.42242218
Registrar:
Name: Synchrone sprl
Website: http://www.synchrone.be
Nameservers:
ns1.synchrone.be
ns2.synchrone.be
Keys:
Flags:
Please visit www.dnsbelgium.be for more info.
Latest domains:
- rentalswest.com.au,
- boviclic.fr,
- valuta-kurser.no,
- dominospizza.ge,
- littlej.fr,
- emit.ch,
- 10tofit.de,
- poderosa.com.pe,
- e-logimax.com,
- samuelwood.me,
- profitsonwallstreet.com,
- multrip.me,
- comarsa.com.pe,
- wealthmakerfinancialservices.com.au,
- tustandas.es,
- grashopper.de,
- kehrer-jet.de,
- beijing2022.cn,
- fivestarpromo.com,
- hangersforshops.com.au